PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10031525m
Common NameCICLE_v10031225mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family WRKY
Protein Properties Length: 451aa    MW: 48498.4 Da    PI: 6.4302
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10031525mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY1079.3e-34250306259
                      --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
             WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                      dD ynWrKYGqK+vkgsefprsYY+Ct+++Cpvkkkvers  d++v+ei+Y+g+Hnh+
  Ciclev10031525m 250 DDPYNWRKYGQKHVKGSEFPRSYYKCTHPNCPVKKKVERSL-DGQVTEIIYKGQHNHP 306
                      89***************************************.***************8 PP

2WRKY41.33.1e-13420443124
                      ---SS-EEEEEEE--TT-SS-EEE CS
             WRKY   1 ldDgynWrKYGqKevkgsefprsY 24 
                      ldDgy+WrKYGqK+vkg+++prsY
  Ciclev10031525m 420 LDDGYRWRKYGQKVVKGNPYPRSY 443
                      59********************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.7E-29238308IPR003657WRKY domain
PROSITE profilePS5081123.41244308IPR003657WRKY domain
SuperFamilySSF1182902.22E-26245308IPR003657WRKY domain
SMARTSM007745.4E-37249307IPR003657WRKY domain
PfamPF031061.8E-25250306IPR003657WRKY domain
Gene3DG3DSA:2.20.25.806.3E-15405443IPR003657WRKY domain
SuperFamilySSF1182903.53E-11412443IPR003657WRKY domain
PROSITE profilePS5081116.949415450IPR003657WRKY domain
SMARTSM007746.3E-5420450IPR003657WRKY domain
PfamPF031069.8E-9421443IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:1900150Biological Processregulation of defense response to fungus
GO:1900425Biological Processnegative regulation of defense response to bacterium
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 451 aa     Download sequence    Send to blast
MAGNEDRAST ASSASLKPST TPSRPTITLP PRASFTESLF NNNGPGSGFG FGFSPGPMTL  60
VSNFFADSDD CKSFSQLLAG AMSSPAAGHL RPNFSEQAGR GSGDAEAGDA DFRFKQNRPA  120
GLVIAQPPPI FAVPPGLSPA TLLESPNFGL FSPAQGAFGM THQQALAQVT AQAAQAQSHT  180
QIPAEYPSSL SSAPTTSMTQ VSSLTANTTT NQQMTPLMPD SSVQMKESSD FSHSDQRPQS  240
SSYVSDKPAD DPYNWRKYGQ KHVKGSEFPR SYYKCTHPNC PVKKKVERSL DGQVTEIIYK  300
GQHNHPPPQS NKRAKDAGSL NGNLNNQGSS ELAPQLKEGA GYSMSKKDQE SSQVTPENIS  360
GTSDSEEVGD AETAVFEKDE DEPDAKRRST EIRVSEPTAS HRTVTEPRII VQTTSEVDLL  420
DDGYRWRKYG QKVVKGNPYP RSYIFSLVVC *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A2e-16250443877Probable WRKY transcription factor 4
1wj2_A2e-16250443877Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00260DAPTransfer from AT2G03340Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006438768.10.0hypothetical protein CICLE_v10031225mg
SwissprotQ9XI901e-157WRKY4_ARATH; Probable WRKY transcription factor 4
TrEMBLV4SVT50.0V4SVT5_9R
STRINGVIT_01s0011g00220.t011e-172(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13960.11e-134WRKY DNA-binding protein 4